Презентации по Английскому языку

Земля совершает полный оборот вокруг Солнца за год (365 дней). Сохраняя постоянный наклон оси, Земля освещается Солнцем по-разному. Когда к Солнцу обращено Северное полушарие, оно больше получает тепла и света – здесь лето. В Южном полушарии в это время –

Roses are red Violets are blue Sugar is sweet And so are you

She is pretty He is handsome

FIGURATIVE LANGUAGE IN COGNITIVE LINGUISTICS“Human cognition is fundamentally shaped by various poetic or figurative processes. Metaphor, metonymy, irony, and other tropes are not linguistic distortions of literal mental thought but constitute basic schemes by which people conceptualize their experience and the

mobile rattle

Review of modern technologies of software design. Organization of the software development process VocabularyWaterfall – сарқырама - водопад gathering – жинау - сборConversion – түрлендіру - преобразованиеDeployment – орналастыру - развертывание, размещениеDomain model - домен моделі - модель предметной областиCompliance –

had+Ved3The playhad begun by then. The Past Perfect Tense обозначает действие, которое завершилось раньше определённого момента в прошлом.12Past PerfectPast Simple

The catThe cat and the mouse Play in the house.The cat is red, the mouse is grey.

Is Sulley sleeping? Is Sulley sleeping?Yes, he is. Sulley is sleeping.

canbebecomebeginbitebreakbringbuildburnbuycatchcomebeganwaswerecaughtbitburntcameboughtbecamebrokebuiltcouldbrought costcutdodrawdrinkdriveeatfallfeelfightfindflydrewcutfounddrankfeltflewfoughtdiddrovefellcostate

Воспользуемся стандартным способом описания, то есть начнем с общего плана и постепенно будем переходить к частному, а именно, к деталям. Кстати, в конце, обязательно, надо сказать несколько слов о теме фотографии и о своем отношении к данной теме.Итак, порядок такой:общее описание того,

How do you get to work?How long does the journey take?How much does the journey cost?It takes about 5 minutes to get there.It costs… The airportbaggagehand luggagecheck-in deskboarding carddeparture loungepassporttrolleyboarding gateexcess baggageplane ticketbureau de changewindow seataisle seatdeparturesarrivalsdelayedlandtake off

Особенности употребления сложного подлежащего (complex subject) Упражнения В английском языке с некоторыми глаголами употребляется сложное подлежащее, представляющее собой сочетание местоимения в именительном падеже или существительного в общем падеже с инфинитивом.

Условные предложения или придаточные предложения условия (Conditionals) – это сложноподчиненные предложения, состоящие из главного предложения (Main clause) и придаточного условия (if-clause), которое часто вводится союзом if. Условные предложения в английском языке используются для описания осуществимых или неосуществимых ситуаций и бывают четырех

Elmo let a pet hen get a red dress. Very well, pet hen! PHONICS Will fills with pills a dish of his big fish. Pills kill! The fish is ill!PHONICS

Standardization milestones1500, Westminster English dominating dialect. The dominance of Latin was not questioned English was inferior.1712, foundation of an English Academy (with the task of ‘Correcting, Improving, and Ascertaining the English Tongue’ )1755, publication of Dr Samuel Johnson’s Dictionary of the

Present Simple (Настоящее простое время) Употребляется:Обычное, повторяющееся действие He plays golf every Sunday. Констатация факта, утверждение истины:We sell our products into many markets.The sun rises in the east.Характеристика человека:My sister sings very well.Действие по графику, расписаниюThe train for London leaves at

The Taj Mahal is a white marble mausoleum located on the southern bank of the Yamuna River in the Indian city of Agra. For the construction of the complex was invited more than 22,000 artists from all over the Empire, as